Some commentators have argued that the credit crunch has resulted in a Essay

Some commentators have argued that the credit crunch has resulted in a shortage of funds being made available to small firms - Essay Example It entails changing ones course towards new things that are considered more creative in generating ones desires. Growth of medium and small businesses encompasses an increment from a low level of business to an advanced level, covering operations over a large scope. There is a wide variety of business forms depending on their size, management, as well as proprietorship; and ranging from public corporations, private companies to the smallest businesses that are singly owned. The operations of each form of a corporation may take several courses where some come together to operate as a group, while others remain singly operated (Smallbone, 2008). For successful enterprises operations, valuers and policy makers or even the proprietors always find it necessary to value companies according to the prevailing operations. Valuation is crucial for it assists the concerned parties in making appropriate decisions as well as laying the corporations on a scale, a factor that helps predict the futu re direction of the companies. More so, different techniques and approaches are employed in the companies’ valuations, which are carried out depending on the form of the company at hand. Private company valuations are thus deemed very important in the day-to-day running of the corporations. There is a need for employment of different techniques in the valuation processes to enhance a comprehensive cover, since each technique yields distinct Results. This paper is aimed at investigating into the valuation of private companies and several valuation techniques in details. Additionally, it will be crucial to establish the advantages and disadvantages of the several methods herein discussed as well as the other alternative methods that could as well be used in the valuation processes in regard to private companies (Bridge, et al., 2003). Valuation of private companies Company valuation is a process that entails the utilization of a sequence of procedures in estimating its value. T his process is mainly carried out by valuators, who come up with a comprehensive report concerning the company’s assets and liabilities. Financial participants in the market mainly use the valuation as a basis for price discussions when the company is on sale. Earlier research has not established a professional method or approach that provides an actual value of a particular company, but numerous approaches and techniques are considered important in determining the value of a company. The current available used techniques only provide an estimate of what the company is worth. Various factors are always considered when valuing a company depending on whether the company is privately owned or publicly owned. Valuation processes are carried out with a lot of caution, considering the company’s assets quality, the nature of its liabilities as well as the intangible assets. It is beneficial to value a company’s assets since it helps the investors in making sound decisi ons concerning their company. Additionally, it is often important in giving prospective buyers some confidence due to the full awareness of the

CASE ANAYLSIS Essay Example | Topics and Well Written Essays - 500 words

CASE ANAYLSIS - Essay Example The workers and American went through a strike in 1997. The second stage is perception of conflict where substantive or emotional differences are sensed. For American, this was in 1998 when the American union found that the management was placing more passengers on Canadian Airlines with which they had entered into an agreement under ‘OneWorld’ than was agreed upon with the union members and the pilots protested by stepping away from volunteering overtime hours. The third stage is described as situation where the need to act becomes paramount. For American, this was highlighted by the clash in 1999 where American integrated RenoAir without closing the deal with the union members. This led to a deliberate attempt by pilots to halt work as they called in sick and went on a strike lasting for ten days. This created a breeding ground for further agitation and dissatisfaction. The union claimed that the company was slowing down the integration process so that they could conti nue paying Renopilots at previous wages which were less than those paid to American pilots. The fourth stage is that of conflict resolution/suppression and the aftermath. This was manifest in the American case when the airline suffered huge losses from the strike and brought a suit in court. U.S. District Judge Joe Kendall of Dallas issued a temporary restraining order against the union and held two of its leaders in contempt for reinforcing the protest. Eventually, the strike ended and work was resumed. The direct conflict management techniques are embedded in the acts of assertiveness and cooperativeness. The former is the attempt to satisfy one’s own concerns by expressing while the latter is to satisfy the concerns of the other party. The example of the workers agreeing to labor concessions and overtimes during difficult times of low profits or acceding to

Expansionary Economic Policy Essay Example | Topics and Well Written Essays - 2250 words

Expansionary Economic Policy - Essay Example Fiscal policy stands for the power possessed by the federal government to tax as well as spend with an intension of achieving the goals of the economy. On the other hand, monetary policy deals with the important programs that make an attempt of increasing or decreasing the nation’s level of business activities through the legal regulation of money supply and credit. Despite the difference between the two, they both have a common goal of either decreasing or increasing the level of the business activities. A better understanding of the above two terms and what they stand for can be handled in the following subheadings. The Theory of Monetary and Fiscal Policy The theory of monetary and fiscal policy reveal that monetary policy stands for the whole process through which the central bank, government, and even the monetary authority are able to take control over three major aspects. The three major aspects include the money supply, interest rates that are meant to achieve the set objectives of stabilizing the economy, and availability of money in the economy. The monetary theory reflects on how one can be able to design the optimum monetary policy without interfering with the lives of other people. The theory goes further to give a suggestion that the monetary policy tends to rest on the relationship that exists between the price at which money can be borrowed, interest rates in an economy, and the total amount of supply of money (Persson 45-46). In addition, the money and fiscal policy make use of several tools in controlling the country’s economic growth, the exchange rates, as well as inflation. It must be noted that the exchange rates can only happen when there is another currency from a foreign country. However, if the currency tends to be under a monopoly of issuance, then there exist high chances that the regulation system might issue the currency through the existing banks, which might end up being tied to a central bank that can easily be con trolled by the authority in altering the money supply and influencing the interest rates. The theory gives an overview of the roles played by the policymakers in regulating the inflation in an economy. Policymakers play a big role in making time-to-time credible announcements that are aimed at informing the citizens on the changes in the interest rates and the amount of money available for borrowing. The theory reflects on the two ways in which the decision made by the policymakers can affect the inflation. In the first case, if firms and other consumers are made to believe that policymakers are working towards lowering the inflation, then there is a likelihood of a true anticipation of lower prices in the near future compared to the current ones. On the other hand, if employees tend to expect high prices in the near future, then there are high chances for employees to draw contracts that entail high wages. This is because employees aim at covering up the high prices in the economy through earning a relatively higher income. However, in an ideal economy, there is always a likelihood of introduction of a wage-setting behavior that is meant to solve such cases that have been mentioned above. The wage setting behavior attempts to balance the relationship between the employee and employer. In case the employees are receiving lower wages that cannot meet the demands of the high prices, then the

Are different patterns of communication in men and women Innately Essay

Are different patterns of communication in men and women Innately different - Essay Example The genetics of men and of women differ, in the same way; their brains perceive their communication thus the exhibition of different communication patterns between them. The different patterns are explained by various factors which are intertwined with the genetics of the respective gender in ways such as. The men are there to listen much and not to talk much while the women talk much and listen less, the men listen with a goal to achieve a solution at the end while women talk to heard and not necessarily to achieve a solution to a problem. The men usually compartmentalize their issues when it comes to communicating while women uses the big picture, this means that a man can be able to separate issues relating to different aspects of their lives as they communicate while women cannot be able to separate them. In other words, they use all the small chunks of information, from family, to relationships and to work and they speak about them, another pattern that can be observed in the co mmunication patterns are that women talk so much in a given period while men actually speak so little (Gray, 2015). All these variations in the communication patterns are innate in that the men can hardly adjust and the women can also hardly adjust. Neuroscience has gone a great way to try and explain the innateness of the communication patterns in the men and women to this date. First, the neuroscientists and researchers have assumed two aspects which are innate and can affect the communication patterns of men as well as of women. These factors includes the larynx which is a biological anatomical organ of the human body and the second one which can explain the observed difference is the corpus callosum in the brain of these subjects (University of Pennyslavia, 2010). To begin with, the larynx is a part for the body in the throat which affects the patterns of communication. This is an

Week1 Knowledge paper Essay Example | Topics and Well Written Essays - 1000 words

Week1 Knowledge paper - Essay Example In addition to the need for goods and services, there was a high demand for housing. This demand spawned the creation of the subdivision. With the proliferation of the automobile, better highways, and television people began to move west as they left the rust belt for the sun belt. While women had been instrumental in working in the wartime factories, after the war women left the factory jobs and became more domestic. This period transformed America into the single wage family headed by a male that became the middle class. The shift in demographics created even more desire and need for products in the marketplace. The economy was growing due to the increase in employment opportunities, more leisure time, and the advertisers ability to reach the public through the new medium of television. The information that I have about the economy during this era comes from older family members who have related their stories to me. In addition, I have picked up images and impressions from television and the Internet. I have always been interested in culture and like to watch some of the old post war movies or 1950s sitcoms. Though I know they are only stories, you can sometimes glean some facts from good fiction. The relationship between the US and the USSR had always been somewhat tense due to the claims of communist infiltration in the US that went back to the 1930s. However, the war against Germany had necessitated that they become allied in their goal of defeating Hitler. Russia endured a heavy burden and paid a great cost during the war. As such, Stalin felt that they were owed the spoils that go to the victor in war. The US, though cautious, was willing to accommodate the Soviets by giving them control of the countries on their western border that would serve as a buffer against Germany and would become their satellite states. After the defeat of Japan, Truman once again

Schematic Interface of Mobile Phone with Micro-Controller Essay Example for Free

Schematic Interface of Mobile Phone with Micro-Controller Essay Labels: circuit GSM/ EDGE Modem in PCI Interface Interface of mobile phone with micro-controller microcontroller schematic Supporting AT commands How To Interface a mobile Phone with micro-controller 8051 family like at89s51, at89s52, at89c2051 etc.The project is aimed at developing and testing the use of mobile phones to remotely control an appliance control system. The microcontroller would then control an device based on the information given to it. The proposed solution will need to be easy to use, simple, secure, robust and be useful on most mobile phones. To achieve this testing will need to be carried out to create a useful system. The report consists of a background into the area of 8051 microcontroller and mobile communication, how they are interfaced to each other and AT (Attention) commands set used in communication. The simplist method to interface a mobile with microcontroller is use mobile phone which support AT Commands. By using this we can directly connect that phone via datacable to microcontroller kit at a baud rate of 9600 and you can send AT commands to that mobile to read and send sms or other data of interest. The first thing in this regard is to find a mobile phone with AT Commands. Recommendation is use sony erricsons 290i . You can use any other mobile suitable for this purpose. The same program with slight modifications for AVR microcontroller. Which avr microcontroller you want to use and what is the sensor you want to interface. After connecting a mobile phone or GSM/GPRS modem to a computer, you can control the mobile phone or GSM/GPRS modem by sending instructions to it. The instructions used for controlling the mobile phone or GSM/GPRS modem are called AT commands. (AT commands are also used to control dial-up modems for wired telephone system.) Dial-up modems, mobile phones and GSM/GPRS modems support a common set of standard AT commands. In addition to this common set of standard AT commands, mobile phones and GSM/GPRS modems support an extended set of AT commands. One use of the extended AT commands is to control the sending and receiving of SMS messages. This device acts as interface between your microcontroller project and a GSM phone. It handles all modem data communication between the GSM phone and your micro-project. The best thing is that it decodes PDU into TEXT on the fly! It’s based on PIC16F877A microcontroller running on 16MHz at 5V. It has an onboard level converter for serial communication with the gsm phone because PIC’s UART RX input pin has a Schmitt trigger triggering at 4,5 5V while the phone is sending only approx. 3V from it’s TX pin. Control takes place by means of SMS (Short text Messages Service). When the mobile receives a predefined text message, like alarm ON or Start pump, the circuit automatically recognizes it as a command, and switches the output accordingly. At the componets level this project of mobile interfacing with microcontroller can be divided into these parts:- 1. Two mobile phones, one for general use and will be handled remotely, the second is specific mobile which will be interfaced with microcontroller 8051. 2. Microcontroller with necessary components inculding power supply, crystal, RS-232 components etc. 3. Interfacinf board, This is interfacinf board which will inculde the optocouplers, relays and other components required for interfacing of different input and output devices to microcontroller. 4. The hardware devices which are to be controlled through this projects will be connected to microcontroller usig above mentioned interfaing board. The procdure for the mobile controlling of different hardware is very easy. process begins on writing a SMS on mobile # 1, which will be transmitted to mobile # 2 through mobile networks. The second mobile will get that SMS and will transmit it to microcontroller via serial communication RS-232. The micocontroller 8051 will check, if it is according to predefine commnad then, according action will be performed.

DI-MS Technique for Analyzing Protein and Peptide Sequences

DI-MS Technique for Analyzing Protein and Peptide Sequences Food Industrial Application DI-MS technique has been widely applied in food industry as it is an easy and high-throughput tool for analyzing protein and peptide sequences, studying the components or structure in food, monitoring the contamination in food. FAB-MS In the study by Terzi, Boyot, Dorsselear, Luu and Trifilieff (1990), the amino acid sequence of a new 6.8 kDa proteolipid from beef heart was determined by employed FAB-MS. The study isolated and purified the 6.8 kDa proteolipid from an acidic methanol/chloroform extract of bovine cardiac muscle, and subsequently analyzed it with the application Cs atom beam of FAB-MS in 1-thioglycerol matrix. The result showed a protonated molecular ion [M+H]+ at m/z 6834.1 and indicated that it have about 60 residues. The 60 residues in the polypeptide were cleaved into three peptide fragments CN1, CN2 and CN3. To characterize these cleavage peptides from amino acid composition, the CN1 and CN2 were ionized using the FAB-MS that performed with Xe atom beam and 1-thioglycerol matrix while the CN3 which also dissolved in 1-thioglycerol was collided by Cs atom beam to produce sample ions. Table 1.0: Chemical mass of cleavage peptides Cleavage peptides Measured mass [M+H]+ [M+Na]+ CN1 1539.0 1560.9 CN2 2100.5 2121.8 CN3 3134.6 From the analysis of the cleavage peptides, the amino acid sequence and peptide fragments of the 6.8 kDa proteolipid were reported as: MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASS 1 CN1 13 14 CN2 31 32 CN3 AAPAHGHH 60 In addition, the FAB-MS technique was applied to determine the structure of the Lycium chinense Miller fruits (Gou-Qi-Zi) in combination with NMR and IR spectroscopy (Chung, Ali, Praveen, Yu, Kim, Ahmad, 2014). L. chinense fruit is a valuable tonic or food, hence there are many researches have been reported to display the properties the L.chinense fruit. For example, the anticancer, antibacterial and antioxidant properties (Lee et al., 2005; Wang, Chang, Inbaraj. Chen, 2010; Zhang et al., 2011) and the antihepatotoxic activity and chemical constituents (Chin et al., 2003; Kim et al., 1997). In the research, the four new compounds (i, ii, iii and iv) that isolated from L. chinense fruits were characterized using the FAB-MS (JMS-700) spectrometer. The antioxidant activity of the four compounds was further studied and it demonstrated that the activity of the compounds followed the order 1423. Table 2.0: Characterization of compound (i) to (iv) Mass Species m/z Detected species Suggestion Compound (i) [M+H]+ 817 C40H65O17 -aromatic acid glycosidic ester 283 [CH3(CH2)16COO]+ -steric acid was esterified with one phenolic group 267 [CH3(CH2)16CO]+ 414 [C15H26O13]+ -three arabinose units bind to one phenolic group 265 [C10H17O8]+ 133 [C5H9O4]+ Compound (ii) [M+H]+ 1165 C50H85O30 -susquiterpene glycoside ester 265 [C10H17O8]+ -few arabinose units bind to the sesquiterpene moiety 223 [C14H27CO]+ 133 [C5H8O5]+ Compound (iii) [M]+ 1309 C58H100O32 -hexaglycoside 341 [C12H21O11]+ -six hexose sugar units bind to each other -unsaturated fatty acid located at terminal position 335 [C21H39COO]+ 325 [C12H21O10]+ 319 [C12H39CO]+ 179 [C6H11O6]+ 163 [C6H11O5]+ Compound (iv) [M+H]+ 841 C31H52O26 -five arabinose units and one glucose unit 661 [C25H41O20]+ -five pentose sugar units bind to a hexose sugar 529 [C25H41O20-C5H8O4]+ 281 [C10H17O9]+ TOF-SIMS TOF-SIMS which widely applied in surface analysis is an important technique for monitoring the contamination in food as the usage of pesticides and fungicide in the agriculture practice will alter and compromise the food quality. The study used TOF-SIMS technique to characterize and compare three different groups of Seggianese olives which classified as untreated (UT), treated with insecticide (dimethoate) and fungicide (copper oxychloride) without washing (TU) and treated with insecticide and fungicide with washing with cold water (TW) (Focardi, et al., 2006). Before measuring the molecular masses of three different groups of olives, the mass calibration was done by using CH3+, C2H3+ and C3H5+ peaks as calibration compounds for positive ions C, CH and C2H peaks as calibration compounds for negative ions. The SIMS data proved the chemical treatments modify the surface composition of olive, resulting in higher intensity signals in TU compared with TW or UT olive spectra. Besides, the intensity of UT and TW olives showed a small variance between each other, demonstrating the washing process was no effective in removing of insecticides and fungicides that will stimulate the composition alterations of olives. Table 3.0: Intensity of few relevant peaks from three different olive samples Peaks Mass peak m/z Attribution Intensity TU olive TW olive UT olive Positive 31.018 CH3O+ 4.23 10-4 6.93 10-5 1.12 10-4 57.074 C4H9+ 1.18 10-2 5.92 10-3 5.08 10-3 73.051 C4H9O+ 7.83 10-4 3.34 10-4 3.08 10-4 147.082 C6H14NOP+ / C6H13NOS+ 2.42 10-4 7.37 10-5 2.93 10-5 Negative 15.994 O 1.13 10-4 2.30 10-3 7.20 10-3 17.002 OH 1.19 10-4 4.42 10-3 5.44 10-3 31.972 S 5.24 10-4 1.99 10-5 1.47 10-5 MALDI-TOF/TOF MS MALDI-MS is a widespread analytical tool for proteins, peptides and oligonucleotides as it offers high ion yields of the intact analyte samples, high sensitivity and accuracy (Lewis, Wei, Siuzdak, 2000). In year 2012, a research about the peptide of peanut hydrolysate has the properties of umami taste had reported by Su, Cui, Zheng, Yang, Ren Zhao. Umami taste is known as the fifth basic taste and it usually described as savory or MSG-like taste. In the study, two novel umami and umami-enhancing peptides were isolated from peanut hydrolysate, purified using chromatography and identified by MALDI-TOF/TOF MS. The analysis of peptides was performed by MALDI-MS equipped with 337nm of UV nitrogen laser and matrix solution as sinapic acid saturated in 0.1% trifluoroacetic acid and acetonitrile. The MALDI-TOF/TOF MS was used to sequence the two novel peptides that termed as P3 and P4 as they produce umami taste. It found that the molecular mass of P3 and P4 was 1091.419 Da and 965.595 Da respectively and the amino sequence of P3 is EGSEAPDGSSR while P4 is SSRDEQSR. Bibliography Chung, I. M., Ali, M., Praveen, N., Yu, B. R., Kim, S. H., Ahmad, A. (2014). New polyglucopyranosyl and polyarabinopyranosyl of fatty acid derivatives from the fruits of Lycium chinense and its antioxidant activity. Food Chemistry, 435-443. Focardi, S., Ristori, S., Mazzuoli, S., Tognazzi, A., Leach-Scampavia, D., Castner, D. G., et al. (2006). ToF-SIMS and PCA studies of Seggianese olives and olive oil. Colloids and Surfaces, 225-232. Lewis, J. K., Wei, J., Siuzdak, G. (2000). Matrix-assited laser desorption/iomization mass spectrometry in peptide and protein analysis. Chichester: John Wiley Sons Ltd. Su, G., Cui, C., Zheng, L., Yang, B., Ren, J., Zhao, M. (2012). Isolation and identification of two novel umami and umami-enhancing peptides from peanut hydrolysate by consecutive chromatography and MALDI-TOF/TOF MS. Food Chemistry, 479-485. Terzi, E., Boyot, P., Dorsselear, A. V., Luu, B., Trifilieff, E. (1990). Isolation and amino acid sequence of a novel 6.8-kDa mitochondrial proteolipid from beef heart. FABS Letters, 122-126. Conclusion In food industry, the analysis of protein and peptide can be performed well by using MALDI-MS and FAB-MS while the application of SIMS is mostly used for detecting the surface of contaminated food. Besides, the structure of the components in foods can also be identified by using the FAB-MS combined with NMR and IR spectroscopies.